PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Zmw_sc01266.1.g00020.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Zoysieae; Zoysiinae; Zoysia
Family NF-YA
Protein Properties Length: 220aa    MW: 24013.5 Da    PI: 9.6475
Description NF-YA family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Zmw_sc01266.1.g00020.1genomeZGD-
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1CBFB_NFYA107.79.4e-34116172158
                       CBFB_NFYA   1 deplYVNaKQyqrIlkRRqkRakleeekkldeksrkpylheSRhkhAlrRpRgsgGrF 58 
                                     +ep+YVNaKQy++Il+RRq Rakle+e+kl  ksrkpylheSRh+hA++R+Rg+gGrF
  Zmw_sc01266.1.g00020.1.sm.mkhc 116 EEPIYVNAKQYHAILRRRQLRAKLEAENKL-VKSRKPYLHESRHQHAMKRARGTGGRF 172
                                     69****************************.**************************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM005217.6E-39114175IPR001289Nuclear transcription factor Y subunit A
PROSITE profilePS5115239.351115175IPR001289Nuclear transcription factor Y subunit A
PfamPF020453.3E-29117172IPR001289Nuclear transcription factor Y subunit A
PRINTSPR006163.5E-25118140IPR001289Nuclear transcription factor Y subunit A
PROSITE patternPS006860120140IPR018362CCAAT-binding factor, conserved site
PRINTSPR006163.5E-25149172IPR001289Nuclear transcription factor Y subunit A
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0010262Biological Processsomatic embryogenesis
GO:0016602Cellular ComponentCCAAT-binding factor complex
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 220 aa     Download sequence    Send to blast
NFNAHNFSVP ENGTIMIQFG HQIPDYDSSA TQSTSGSQQE VSGMSEGSLN EHNDRSGNLD  60
GYTKSDENKM MSALSLGNPA AYAHQKSDRS QSYMHPQIVG MVPSSRVPLP IEPAAEEPIY  120
VNAKQYHAIL RRRQLRAKLE AENKLVKSRK PYLHESRHQH AMKRARGTGG RFLNTKQQQA  180
EAAGGGSSDA PANNGGGLFS KHEYSLPPGD LRYHARGGGA
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4awl_A3e-24116178264NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT ALPHA
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004985516.11e-120PREDICTED: nuclear transcription factor Y subunit A-7 isoform X2
SwissprotQ9LVJ72e-42NFYA6_ARATH; Nuclear transcription factor Y subunit A-6
TrEMBLK4AEG21e-120K4AEG2_SETIT; Uncharacterized protein
STRINGSi037269m1e-119(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP137338121